PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00453g01011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 378aa    MW: 43154.4 Da    PI: 8.4614
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00453g01011.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.31.4e-161665251
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                               i++k  r v+fskR+  ++KKAeELS +++ae  v++fs++gk y y+s
  Peinf101Scf00453g01011.1 16 LIQSKQARCVSFSKRKSSLFKKAEELSNMTGAESGVLLFSPSGKTYSYCS 65
                              699*********************************************96 PP

2SRF-TF421.2e-13204251350
                               --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                    SRF-TF   3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                               i+ k  r+v+fskR++ ++K AeELS L++ae  v+++s++g+ y  +
  Peinf101Scf00453g01011.1 204 IKLKQARYVSFSKRKASLFKIAEELSNLTGAESGVLLLSPNGNTYSHC 251
                               777899************************************988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.628767IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-22766IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.37E-22883IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-13929IPR002100Transcription factor, MADS-box
PfamPF003192.4E-171763IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-132944IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-134465IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.325194254IPR002100Transcription factor, MADS-box
SMARTSM004328.9E-13194253IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.12E-16196266IPR002100Transcription factor, MADS-box
PfamPF003191.0E-13204249IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MERKRSMGRQ KIEMKLIQSK QARCVSFSKR KSSLFKKAEE LSNMTGAESG VLLFSPSGKT  60
YSYCSTSIEE IIDKFFQWKQ DESDDDESDN PEKLSRVFKA FDDLRDEIKT IFELEKGRKR  120
RYNIIHPDSK ISPDKNMLNR LVGCKLQLDK LKKLTSRLQE LMPSTSRSVP STSAKPCLSF  180
DLNILPGLDE GECSDRQKIE MKLIKLKQAR YVSFSKRKAS LFKIAEELSN LTGAESGVLL  240
LSPNGNTYSH CSTSIEEITD NFFRWKQDGS DGDESDNLEK MSSVFKAFDD LRDEIKIINE  300
LEKSRRCRYN IIHPGSEIPP DKNMLNRLIE CKLPLDKLKK ITIHLQELMP STSSSLSSTF  360
AKPCLNFDLN VLPGLDEG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148153DKLKKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015159413.18e-49PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLM1AZT91e-50M1AZT9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000338613e-50(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17801260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.17e-14AGAMOUS-like 29